PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf04410g03001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Dof
Protein Properties Length: 319aa    MW: 34625 Da    PI: 6.7839
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf04410g03001.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.28.6e-393089261
                    zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                              +++ lkcprCds ntkfCyynny+lsqPr+fCk+CrryWtkGG lrnvPvGgg+rk+k+s
  Niben101Scf04410g03001.1 30 NQQVLKCPRCDSPNTKFCYYNNYNLSQPRHFCKSCRRYWTKGGVLRNVPVGGGCRKSKRS 89
                              68899****************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-252983IPR003851Zinc finger, Dof-type
PfamPF027013.4E-333288IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.6653488IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103672IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MQDIHPIGGG GGRFFGGGGD RRLRPNHHQN QQVLKCPRCD SPNTKFCYYN NYNLSQPRHF  60
CKSCRRYWTK GGVLRNVPVG GGCRKSKRSK PKPAPPSDAA AEAADDASEE HKSNSNSSSE  120
SSSLTATTTA AAAANTSGAA TAEVVSAASS NSTSTFLNFH ESNFFLPSST NSSFGHQPLM  180
DHSAEGQIFQ DIGNFTNLMT SSNDPSAVGF DMMEIPAYRL PENQNSNEQW NQPAKMVGTD  240
QPVDDLKMEQ MDTGFMNQTG RVEFGLQQNR VNNSEIAPLD WQIGGVGGDG EHGLYDLTGT  300
LTAELRQGKL NGTKNYQRM
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11018GGRFFGGGG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016456972.11e-149PREDICTED: dof zinc finger protein DOF5.4-like
TrEMBLA0A0V0I0Q01e-107A0A0V0I0Q0_SOLCH; Putative dof zinc finger protein DOF5.4-like
STRINGPGSC0003DMT4000103971e-102(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.14e-32DOF zinc finger protein 1